PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G24020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 310aa    MW: 33884.6 Da    PI: 6.0781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G24020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.7e-091863148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g  +++    g+ R++k+c++rw +yl
  LPERR01G24020.1 18 KGLWSPEEDEKLYNHIIRYGVG--TSVVCDPGLQRCGKSCRLRWINYL 63
                     678*******************..6666677789************97 PP

2Myb_DNA-binding47.44.6e-1569112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  LPERR01G24020.1  69 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 112
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-161366IPR009057Homeodomain-like
PROSITE profilePS512948.7921363IPR017930Myb domain
SuperFamilySSF466891.6E-2316110IPR009057Homeodomain-like
SMARTSM007171.1E-61765IPR001005SANT/Myb domain
PfamPF002493.1E-71863IPR001005SANT/Myb domain
PROSITE profilePS5129423.91864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2567118IPR009057Homeodomain-like
SMARTSM007171.5E-1468116IPR001005SANT/Myb domain
PfamPF002492.2E-1369112IPR001005SANT/Myb domain
CDDcd001671.66E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRHACATTA GVQQKLRKGL WSPEEDEKLY NHIIRYGVGT SVVCDPGLQR CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEDAI VGLHEILGNR WSQIASHLPG RTDNEIKNFW NSSLKKKLRQ  120
RGIDPSTHKP ISVSSSASAA ALDTSPQDQK PPATAADGFA VKQHQHQQQV FDPFPVTDSF  180
GVGFDAAGMA LYGHIGGGKD VSAAFLDYSS VLDVSENLGY GESSSNSSNW NCGGAVGAPE  240
VNNALESEAL HWATESKVEP LVGYGGEGDA MEHKFVLPCH GQQEQSMPHF DFDVGRSMVV  300
GDFNDLEYFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27161185108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117820.0AK111782.1 Oryza sativa Japonica Group cDNA clone:J023084H22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644576.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200272e-98MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0D9V4N20.0A0A0D9V4N2_9ORYZ; Uncharacterized protein
STRINGOB01G37060.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-65myb domain protein 61